PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_25600V3.1.p
Common Namecol-2, PHYPADRAFT_186706
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family CO-like
Protein Properties Length: 365aa    MW: 39489.4 Da    PI: 5.9294
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_25600V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.39.8e-06343438
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Ht 38
                       + C+ ++   +  +C+ +  +lC+ C  + H g       H+
  Pp3c7_25600V3.1.p  3 KSCDACHISSAVVYCRADAAYLCAGCDGKVH-GanklasrHE 43
                       67*****999*****************9999.4456666666 PP

2zf-B_box22.62.2e-074590342
           zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                        ++C+ +e   +   C+ +   lC +C + +H+       H++vp+
  Pp3c7_25600V3.1.p 45 VWMCEVCEVAVAVVTCKADAASLCVSCDTDIHSAnplaqrHERVPV 90
                       689******99*********************66899999999986 PP

3CCT70.25.2e-24298341144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        Rea+++RYkeKr++RkFeK+irY+sRKa+AesRpR+KGrF+k++
  Pp3c7_25600V3.1.p 298 REARVMRYKEKRQKRKFEKTIRYASRKAYAESRPRIKGRFAKRT 341
                        9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.314147IPR000315B-box-type zinc finger
SMARTSM003361.2E-8147IPR000315B-box-type zinc finger
CDDcd000217.70E-5547No hitNo description
PROSITE profilePS5011910.314390IPR000315B-box-type zinc finger
PfamPF006431.1E-54590IPR000315B-box-type zinc finger
SMARTSM003362.1E-94890IPR000315B-box-type zinc finger
CDDcd000210.001926090No hitNo description
PfamPF062035.8E-18298340IPR010402CCT domain
PROSITE profilePS5101716.569298340IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MPKSCDACHI SSAVVYCRAD AAYLCAGCDG KVHGANKLAS RHERVWMCEV CEVAVAVVTC  60
KADAASLCVS CDTDIHSANP LAQRHERVPV QPLFDCASSA REAHISVPFP ESECHETLKG  120
VEDSCVAEAG SWLLPHPKIP TNAIIRGSAA ADEAPDSPFR ARPFSPKLKK QKVDLAADIF  180
SDVDPFLELD DATVTGIQPD SLVPVHIPEG SEDSPSLAHS MEPSFTTDFH LSEKSGYSFG  240
TSTLTHSISC SSVDAAVVPD SSLSDISTPY PLDSQGAQEL SGTRMPQQVS GPIDTVDREA  300
RVMRYKEKRQ KRKFEKTIRY ASRKAYAESR PRIKGRFAKR TDSDVEQLFS SCSMDSSFGV  360
VPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.48150.0gametophore| protonema| sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ8901070.0AJ890107.1 Physcomitrella patens col-2 gene for CONSTANS-like 2, exons 1-3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001767869.10.0predicted protein
TrEMBLQ4W1E90.0Q4W1E9_PHYPA; CONSTANS-like 2
STRINGPP1S97_109V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-77CONSTANS-like 4
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]